PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G30350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 340aa    MW: 36443.4 Da    PI: 4.4248
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G30350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.3e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT++Ed +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  ORUFI02G30350.1 16 RGSWTPQEDMRLIAYIQKHGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding49.78.3e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++ +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  ORUFI02G30350.1  69 RGNFTADEEDTIIKLHGLLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-23766IPR009057Homeodomain-like
PROSITE profilePS5129414.361163IPR017930Myb domain
SuperFamilySSF466891.01E-2913110IPR009057Homeodomain-like
SMARTSM007171.1E-121565IPR001005SANT/Myb domain
PfamPF002493.4E-151663IPR001005SANT/Myb domain
CDDcd001672.55E-101863No hitNo description
PROSITE profilePS5129423.664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2567118IPR009057Homeodomain-like
SMARTSM007175.9E-1468116IPR001005SANT/Myb domain
PfamPF002493.4E-1469114IPR001005SANT/Myb domain
CDDcd001672.16E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRGRAPCCA KVGLNRGSWT PQEDMRLIAY IQKHGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTADEEDTI IKLHGLLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRVSQ  120
REKPGDTKKK GKAADASDDA DAHSPSSSAS SSTTTAANNN NSGDTAGEQC GTSKEPENVD  180
VSFFEQDIDI SDMLVDAPTE APLVAAPMPP SPCSSSSLTT TTCVGAVSDE LLDLPEIDIE  240
PDIWSIIDGY GGDEPGDGDA TVPCTASPGE EGAEWWVENL EKELGLWGPM DESLAHPDPP  300
GQVCYPGPLT ETEGDPVSTY FQSGPTASPL QEIASPAVLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-26141182105C-Myb DNA-Binding Domain
1msf_C1e-26141182105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117200.0AK111720.1 Oryza sativa Japonica Group cDNA clone:J023030I19, full insert sequence.
GenBankAK1119330.0AK111933.1 Oryza sativa Japonica Group cDNA clone:001-017-B10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623616.10.0PREDICTED: myb-related protein Zm1
SwissprotP200241e-135MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0E0NJK60.0A0A0E0NJK6_ORYRU; Uncharacterized protein
TrEMBLQ6YUQ60.0Q6YUQ6_ORYSJ; Os02g0695200 protein
STRINGLOC_Os02g46780.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.12e-68myb domain protein 63